Vergleich

UBE2C Protein

ArtNr OPPA00863
Hersteller AVIVA Systems Biology
Menge 5 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host E.coli
Purity Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQESKQVTSQEP.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias UBCH10,dJ447F3.2
Similar products UBE2C
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Room Temperature
Gene symbol
UBE2C
Protein size
Recombinant
Product format
Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.
Reconstitution and storage
Lyophilized UBE2C although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2C should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target
Recombinant Human Ubiquitin Conjugating Enzyme E2C
Protein accession_num
NP_008950.1
Protein name
Ubiquitin-conjugating enzyme E2 C

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen