PPARG Protein

ArtNr	OPPA01141
Hersteller	AVIVA Systems Biology
Menge	2 ug
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Other Lipid\Cholesterol Metabolism Modulators
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95% as determined by SDS-PAGE. Mass spectrometry of tryptic digest products for identity determination.
Sequence	MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLM1,CIMT1,NR1C3,PPARG1,PPARG2,PPARG5,PPARgamma
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Gene symbol	PPARG
Protein size	Recombinant
Product format	PBS 50% glycerol, 0.01% azide. Physical appearance: Sterile Filtered clear solution.
Reconstitution and storage	Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time. Avoid multiple freeze-thaw cycles.
Description of target	Recombinant Human Peroxisome Proliferator Activated Receptor Gamma
Protein accession_num	NP_005028.4
Protein name	Peroxisome proliferator-activated receptor gamma

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA01141-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 2 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern