MICA Protein

ArtNr	OPPA01280
Hersteller	AVIVA Systems Biology
Menge	2 ug
Kategorie	Oncology By Cell Type Carcinoma Melanoma Peptides & Proteins Recombinant Proteins Adenocarcinoma
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQ
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PERB11.1
Similar products	MICA
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	MICA
Protein size	Recombinant
Product format	Lyophilized from a concentrated (1mg/ml) solution containing no additives. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Reconstitution and storage	Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MICA should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Human MHC class I chain-related gene A
Protein accession_num	NP_000238.1
Protein name	MHC class I polypeptide-related sequence A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPPA01280-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 2 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern