Trypsin Human, Yeast - Recombinant Human Trypsin, Yeast (1mg)

Hersteller AVIVA Systems Biology
Kategorie
Typ Proteins
Specific against other
Format The Porcine Trypsin is formulated with 1mM HCl and 20mM CaCl2, pH-3. Physical appearance: Sterile Filtered clear liquid solution.
Menge 1mg
Host Pichia Pastoris
ArtNr OPPA02041
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Description
Trypsin Yeast, Recombinant Human Trypsin, Yeast
Gene symbol
Trypsin Yeast
Alias symbols
Trypsin Porcine, Trypsin Porcine Recombinant
Peptide sequence
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVV SAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKI ITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSL PRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLK APVLSDSSCKSSYPGQITGNMICVGF LEGGKDSC QGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTK VCNYVNWI QQTIAAN.
Reconstitution and storage
Recombinant Porcine Trypsin should be stored at 2-8C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA).
Description of target
Recombinant Human Trypsin, Yeast

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 1mg
Lieferbar: Out of stock
Fragen zum Produkt?
 
Schließen