« Zurück
Startseite /
Recombinant Human Beta-2 adrenergic receptor (ADRB2)

Recombinant Human Beta-2 adrenergic receptor (ADRB2)

ArtNr	BM-RPC20707-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity Cardiovascular Research Heart Failure Myocardial Infarction Hypertension Arrhythmias
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVG MGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFW CEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYR ATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNL SQV
Protein Familie	G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-2 adrenoreceptor Short name: Beta-2 adrenoceptor
Similar products	Beta-2 adrenoreceptor Short name: Beta-2 adrenoceptor
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	62.5 kDa
Expression Region	1-413aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Subcellular location	Cell membrane, Multi-pass membrane protein, Early endosome
Function	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway	Calciumsignalingpathway
Manufacturer - Gene Name	ADRB2
Sequence Information	Full Length of BC063486

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern