Vergleich

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

ArtNr BM-RPC20741-50ug
Hersteller Biomatik
Menge 50 UG
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Sequence MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDG RSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLL FSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANH TPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEEC PLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKR AETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIG CQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASD SPF
Protein Familie Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10
Similar products inwardly rectifying subfamily J member 10, ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Shipping Temperature
Ice packs
Storage Conditions
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)
58.5 kDa
Expression Region
1-379aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration
1 year
Endotoxin
Not Tested
Relevance
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules
Subcellular location
Membrane, Multi-pass membrane protein, Basolateral cell membrane
Involvement in disease
Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES)
Function
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
Activity
Not Tested
Tissue Specificity
Expressed in kidney (at protein level).
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name
KCNJ10
Sequence Information
Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 UG
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen