« Zurück
Startseite /
Recombinant Human Bone morphogenetic protein 7 (BMP7)

Recombinant Human Bone morphogenetic protein 7 (BMP7)

ArtNr	BM-RPC25587-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Protein Familie	TGF-beta family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Osteogenic protein 1,OP-1INN: Eptotermin alfa
Similar products	Osteogenic protein 1, OP-1INN: Eptotermin alfa
Lieferbar
Manufacturer - Conjugate / Tag	Unconjugated, N-Terminal Gst-Tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	19.7 kDa
Expression Region	293-431aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Subcellular location	Secreted
Function	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Activity	Not Tested
Tissue Specificity	Expressed in the kidney and bladder. Lower levels seen in the brain.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway	Hipposignalingpathway
Manufacturer - Gene Name	BMP7
Sequence Information	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern