Hersteller |
Biomatik
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Menge |
100ug |
ArtNr |
BM-RPC25626-100ug |
Targets |
MADCAM1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Gene Name |
MADCAM1 |
Alternative Names |
Short name: MAdCAM-1 Short name: hMAdCAM-1 |
Uniprot |
Q13477 |
Source |
Yeast |
Expression Region |
19-317aa |
AA Sequence |
QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAD RGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSA AGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPA ALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQEL EGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPP LGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPT SPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPE PPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQA GPTQGEVIPTGSSKPAGDQ |
Sequence Info |
Partial |
Tag Info |
C-terminal Myc-tagged and C-terminal 6xHis-tagged |
Theoretical MW |
34.4 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Function |
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding. |
Subcellular location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.