« Zurück
Home /
Recombinant Human Haptoglobin (HP)

Recombinant Human Haptoglobin (HP)

Hersteller	Biomatik
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity
Typ	Proteins Recombinant
Specific against	Human
Menge	100ug
ArtNr	BM-RPC25902-100ug
Targets	HP
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	HP
Alternative Names	Alternative name(s): Zonulin
Uniprot	P00738
Source	E.coli
Expression Region	19-406aa
AA Sequence	VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCK NYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEA DDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDG VYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANP VQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK QLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVM PICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKY VMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPI LNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT WYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTI AEN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-B2M-tagged
Theoretical MW	57.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Function	As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Involvement in disease	Anhaptoglobinemia (AHP)
Subcellular location	Secreted
Protein Families	Peptidase S1 family
Tissue Specificity	Expressed by the liver and secreted in plasma.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern