« Zurück
Home /
Recombinant Human Interleukin-5 (IL5)

Recombinant Human Interleukin-5 (IL5)

Hersteller	Biomatik
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis By Cell Type Carcinoma Hematology Leukemia Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis
Typ	Proteins Recombinant
Specific against	Human
Menge	1mg
ArtNr	BM-RPC25912-1mg
Targets	IL5 ;; IL6
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Gene Name	IL5
Alternative Names	B-cell differentiation factor I Eosinophil differentiation factor T-cell replacing factor Short name: TRF
Uniprot	P05113
Source	Yeast
Expression Region	20-134aa
AA Sequence	IPTEIPTSALVKETLALLSTHRTLLIANETLRIPV PVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFK NLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLG VMNTEWIIES
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	15.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Function	Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Subcellular location	Secreted
Protein Families	IL-5 family
Paythway	Jak-STATsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 27.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern