Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10), partial (Active)

Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, TNF-Related Apoptosis-Inducing Ligand, Protein TRAIL, CD253, TNFSF10, APO2L, TRAIL

E.coli

RERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGR KINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYI YSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDP ILLMKSARNSCWSKDAEYGLYSIYQGGIFELKEND RIFVSVTNEHLIDMDHEASFFGAFLVG

Tag-Free

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Human TNFSF10 is a type II transmembrane protein with an intracellular N-terminus and a ´TNF homology domain´ (THD) at the extracellular C terminus. TNFSF10 can interact with several distinct receptors. Two of these receptors that belongs to TNFR superfamily, DR4 (TRAIL-R1) and DR5 (TRAIL-R2/TRICK2), are plasma membrane proteins containing intracellular death domains essential for activating apoptosis. TNFSF10 is promising for cancer therapy because it is cytotoxic and activates apoptosis in the majority of malignant cells, but not in normal cells.

Membrane, Single-pass type II membrane protein

Widespread; most predominant in spleen, lung and prostate.