Hersteller |
Biomatik
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Monkey |
Menge |
100ug |
ArtNr |
BM-RPC25657-100ug |
Targets |
ACE |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Gene Name |
LGMN |
Alternative Names |
Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1 |
Uniprot |
Q4R4T8 |
Source |
E.coli |
Expression Region |
18-323aa |
AA Sequence |
VPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHA YQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVI NRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAE AVKGIGSGKVLKSGPQDHVFVYFTDHGSTGILVFP NEDLHVKDLNETIYYMYKHKMYRKMVFYIEACESG SMMNHLPDNINVYATTAANPRESSYACYYDEKRST YLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT NTSHVMQYGNKTISTMKVMQFQGMKHKASSPLSLP PVTHLDLTPSPDVPLTIMKRKLMNTN |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
39.7 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system |
Function |
Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system (By similarity). |
Subcellular location |
Lysosome |
Protein Families |
Peptidase C13 family |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.