Vergleich

Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1)

ArtNr BM-RPC20582-50ug
Hersteller Biomatik
Menge 50 UG
Kategorie
Typ Proteins
Specific against Mouse (Murine, Mus musculus)
Host E.coli
Konjugat/Tag Unconjugated, Myc, SUMO
Purity >90% by SDS-PAGE
Sequence MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias hnRNP A2/B1
Versandbedingung Gekühlt
Lieferbar
Specificity Mouse (Mus musculus)
Manufacturer - Category
Protein
Manufacturer - Targets
Hnrnpa2b1
Manufacturer - Conjugate / Tag
Unconjugated, N-Terminal 6Xhis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)
57.4kDa
Protein Length
Full Length
Protein Type
Recombinant Protein
Expression Region
1~353aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures.
Expiration
12 months
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Endotoxin
Not Tested
Quality Systems
This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description
Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Hnrnpa2b1. Target Synonyms: hnRNP A2/B1. Accession Number: O88569. Expression Region: 1~353aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 57.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1) is a purified Recombinant Protein.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Activity
Not Tested

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 UG
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen