« Zurück
Startseite /
Recombinant Mouse Beta-tectorin (Tectb)

Recombinant Mouse Beta-tectorin (Tectb)

ArtNr	BM-RPC20608-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Sequence	KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQ LALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQ SEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCT YHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSL NFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKG LSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPT DETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWL HCE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	36.5 kDa
Expression Region	18-305aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.
Subcellular location	Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, Secreted, extracellular space, extracellular matrix
Function	One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	Tectb
Sequence Information	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern