Hersteller |
Biomatik
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse |
Menge |
50ug |
ArtNr |
BM-RPC20728-50ug |
Targets |
DPP4 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Gene Name |
Dpp4 |
Alternative Names |
Dipeptidyl peptidase IV Short name: DPP IV T-cell activation antigen CD26 Thymocyte-activating molecule Short name: THAM CD_antigen: CD26 Cleaved into the following 2 chains: Dipeptidyl peptidase 4 membrane form Alternative name(s): Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s): Dipeptidyl peptidase IV soluble form |
Uniprot |
P28843 |
Source |
in vitro E.coli expression system |
Expression Region |
29-760aa |
AA Sequence |
SKDEAAADSRRTYSLADYLKSTFRVKSYSLWWVSD FEYLYKQENNILLLNAEHGNSSIFLENSTFESFGY HSVSPDRLFVLLEYNYVKQWRHSYTASYNIYDVNK RQLITEEKIPNNTQWITWSPEGHKLAYVWKNDIYV KVEPHLPSHRITSTGEENVIYNGITDWVYEEEVFG AYSALWWSPNNTFLAYAQFNDTGVPLIEYSFYSDE SLQYPKTVWIPYPKAGAVNPTVKFFIVNIDSLSSS SSAAPIQIPAPASVARGDHYLCDVVWATEERISLQ WLRRIQNYSVMAICDYDKINLTWNCPSEQQHVEMS TTGWVGRFRPAEPHFTSDGSSFYKIISDKDGYKHI CHFPKDKKDCTFITKGAWEVISIEALTSDYLYYIS NQYKEMPGGRNLYKIQLTDHTNVKCLSCDLNPERC QYYAVSFSKEAKYYQLGCWGPGLPLYTLHRSTDHK ELRVLEDNSALDRMLQDVQMPSKKLDFIVLNETRF WYQMILPPHFDKSKKYPLLLDVYAGPCSQKADASF RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAI NRRLGTLEVEDQIEAARQFVKMGFVDSKRVAIWGW SYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDS VYTERYMGLPIPEDNLDHYRNSTVMSRAEHFKQVE YLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMW YTDEDHGIASSTAHQHIYSHMSHFLQQCFSLH |
Sequence Info |
Extracellular Domain |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Theoretical MW |
100.5 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. |
Function |
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. |
Subcellular location |
Dipeptidyl peptidase 4 soluble form: Secreted, Note=Detected in the serum and the seminal fluid, SUBCELLULAR LOCATION: Cell membrane, Single-pass type II membrane protein, Apical cell membrane, Single-pass type II membrane protein, Cell projection, invadopodium membrane, Single-pass type II membrane protein, Cell projection, lamellipodium membrane, Single-pass type II membrane protein, Cell junction, Membrane raft |
Protein Families |
Peptidase S9B family, DPPIV subfamily |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.