Hersteller |
Biomatik
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse |
Menge |
50ug |
ArtNr |
BM-RPC26325-50ug |
Targets |
TNC |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Gene Name |
Tnc |
Alternative Names |
Hexabrachion Tenascin-C Short name: TN-C Hxb |
Uniprot |
Q80YX1 |
Source |
Baculovirus |
Expression Region |
1884-2099aa |
AA Sequence |
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQA LEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYA AGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDH GESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSM NYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNC HRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEM KLRPSN |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
28.8 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells |
Function |
Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8 |
Subcellular location |
Secreted, extracellular space, extracellular matrix |
Protein Families |
Tenascin family |
Tissue Specificity |
Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine (PubMed:14709716). High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult mice. Low level of isoform 2 in adult brain. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.