Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3)

Nip3

in vitro E.coli expression system

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNG DMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDT NRAEIDSHSFGEKNSTLSEEDYIERRREVESILKK NSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRN TSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIY IGRRLTTSTSTF

N-terminal 10xHis-tagged

>85% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway

Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein