« Zurück
Startseite /
Recombinant Mouse Embigin (Emb)

Recombinant Mouse Embigin (Emb)

ArtNr	BM-RPC26462-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Teratocarcinoma glycoprotein Gp-70 (Gp70)
Similar products	Teratocarcinoma glycoprotein Gp-70 (Gp70)
Lieferbar
Gene Name	Emb
Alternative Names	Teratocarcinoma glycoprotein Gp-70 (Gp70)
Uniprot	P21995
Source	in vitro E.coli expression system
Expression Region	34-330aa
AA Sequence	DPTDPTFTSLPVREEMMAKYSNLSLKSCNISVTEK SNVSVEENVILEKPSHVELKCVYTATKDLNLMNVT WKKDDEPLETTGDFNTTKMGNTLTSQYRFIVFNSK QLGKYSCVFGEKELRGTFNIHVPKAHGKKKSLIAY VGDSTVLKCVCQDCLPLNWTWYMGNETAQVPIDAH SNEKYIINGSHANETRLKIKHLLEEDGGSYWCRAT FQLGESEEQNELVVLSFLVPLKPFLAILAEVILLV AIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSN GIENNVPRYRKTDSADQ
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	36.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Plays a role in targeting the monocarboxylate transporters SLC16A1 and SLC16A7 to the cell membrane. Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates.
Function	Plays a role in targeting the monocarboxylate transporters SLC16A1 and SLC16A7 to the cell membrane (By similarity). Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates.
Subcellular location	Cell membrane, Single-pass type I membrane protein, Cell junction, synapse
Tissue Specificity	Only member of the immunoglobulin superfamily to be expressed in embryonal carcinoma cells, which resemble multipotential cells of early embryos.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern