« Zurück
Startseite /
MMP 14 (MT1-MMP) hemopexin domain, His-tagged

MMP 14 (MT1-MMP) hemopexin domain, His-tagged

ArtNr	BTZ-30100133
Hersteller	BioTeZ
Menge	200 ug/1 ml
Kategorie	Oncology Neuroscience Neuroinflammation Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Konjugat/Tag	His
Protein Familie	Matrix Metalloproteinases, matrixins
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Purity	>95%
Product Subcategory	EC 3.4.24.80
Pathway and Disease	Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion
Description	MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
Applications Info	Investigation of hemopexin domain interaction with ligands, antigen standard
Alternate Names	Membrane-Type-1 Matrix Metalloproteinase
Sequence	GPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQV MDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKG DKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAAL FWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIK VWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQ KLKVEPGYPKSALRDWMGCPSGGVTHHHHHH
Accession No	P50281
Composition	50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2
Storage	Store at -70C
Target Modification	No
Expression System	E.coli
Product Subtype	protein fragment
Active?	No
Tag	His-tagged
Gene ID	4323
Molecular Weight	25 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant MT1-MMP hemopexin domain is produced as a periplasmic protein in E. coli.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	MMP14 (partial)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug/1 ml

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern