Vergleich

Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody Europäischer Partner

ArtNr BOS-M30940
Hersteller Boster
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen IHC
Clon DG1/447 + DOG-1.1
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1 Kappa
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Anoctamin-1;Discovered on gastrointestinal stromal tumors protein 1;Oral cancer overexpressed protein 2;Transmembrane protein 16A;Tumor-amplified and overexpressed sequence 2;ANO1;DOG1, ORAOV2, TAOS2, TMEM16A;
Lieferbar
Manufacturer - Category
Monoclonal Antibodies, Primary Antibodies
Manufacturer - Isotype
IgG1, kappa + IgG1, kappa
Storage Conditions
Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Observed Molecular Weight
114078 MW
Clonality
Monoclonal
Application Details
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.
Manufacturer - Gene Name
TMEM16A
Gene Full Name
Anoctamin-1
Background
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST' s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST' s, including all c-kit negative GIST' s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST' s is nearly identical: 94.4% vs. 94.7%.
Immunogen
Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Contents
Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Purification
200ug/ml of antibody purified from Bioreactor Concentrate by Protein A/G.
Concentration
Purified antibody with BSA and azide at 200ug/ml
Manufacturer - Research Category
Cell Type Markers, Tags & Cell Markers, Tumor Associated
Protein Function
Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Subcellular Localization
Cell Surface and Cytoplasm
Short Description
Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody (Catalog # M30940). Tested in IHC applications. This antibody reacts with Human.
Description
Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody (Catalog # M30940). Tested in IHC applications. This antibody reacts with Human.
Tissue Specificity
Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?