FOXG1 (Forkhead Box Protein G1,Brain Factor 1,BF-1,BF1,Brain Factor 2,BF-2,BF2,hBF-2,Forkhead Box Protein G1A,Forkhead Box Protein G1B,Forkhead Box Protein G1C,Forkhead-related Protein FKHL1,HFK1,Forkhead-related Protein

Mab

IgM, k

-20°C

Supplied as a liquid in ascites fluid.

Partial recombinant corresponding to aa183-291 from human FOXG1B (NP_005240) with GST tag. MW of the GST tag alone is 26kD.

Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.