NME4 (NDPKD, NDPK-D, NM23D, NM23H4, nm23-H4, Nucleoside Diphosphate Kinase D, Nucleoside Diphosphate Kinase Mitochondrial, NDP Kinase Mitochondrial, NDK)

Antibodies / Antibodies-Protein Kinases

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human NME4, aa1-187 (NP_005000.1).

NME4, also known as nucleoside diphosphate kinase, mitochondrial, belongs to the NDK family. NME4 are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4. NME4 plays a major role in the synthesis of nucleoside triphosphates other than ATP.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.