« Zurück
Startseite /
Recombinant Mouse IL-17A/CTLA-8 Protein

Recombinant Mouse IL-17A/CTLA-8 Protein

ArtNr	RP01460-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 90% by SDS-PAGE.
NCBI	IL-17A/CTLA-8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Il17,Ctla8,IL-17,Ctla-8,IL17A,IL-17A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	<0.1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	15.82 kDa
Description	Recombinant Mouse IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Ala158) of mouse IL-17A/CTLA-8 (Accession #NP_034682.1.) fused with a 6×His tag at the C-terminus.
Background	IL17, also known as IL17a, is a cytokine that belongs to the IL-17 family. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL-17 regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of IL-17 are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis, and multiple sclerosis.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala26-Ala158
Recommended Dilution	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17A/CTLA-8 at 2 μg/mL (100 μL/well) can bind Mouse IL-17RA/CD217 with a linear range of 0. 1-26 ng/mL.Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells in the presense of 2 ng/mL TNFα(Catalog: RP01071).The ED₅₀ for this effect is 0. 26-1. 04 ng/mL, corresponding to a specific activity of 9. 62×10⁵~3. 85×10⁶ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	15.82 kDa
Gene Symbol	IL-17A/CTLA-8

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01460-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern