Elafin - 0.1 mg

ArtNr	AS-61641
Hersteller	AnaSpec
Menge	0.1 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln-OH (Disufide bonds bet
Citations	King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Elafin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	5999.5
Description	This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Product Group	LB1A2Z
Research Area	Immunology and Infectious disease / Lyophilized
Sequence One-Letter Code	AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
GTIN	5400535151676
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-61641-safety-datasheet.pdf