Vergleich

Recombinant Human CD40 Ligand

ArtNr CS-CRC800B
Hersteller Cell Sciences
Menge 50 ug
Kategorie
Typ Proteins
Specific against Human (Homo sapiens)
Host E.coli
Purity >95.0% by HPLC and SDS-PAGE
Sequence MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products CD40L, TRAP, gp39, CD154, TNFSF5, HIGM1, IGM, IMD3, T-BAM, hCD40L, CD40 antigen ligand, T-B cell-activating molecule, TNF-related activation protein, OTTHUMP00000024130, tumor necrosis factor (ligand) superfamily member 5
Lieferbar
Manufacturer - Category
Biomolecules
Storage Conditions
This lyophilized preparation is stable at 2-4C, but should be kept desiccated at -20C for long term storage. Upon reconstitution, the preparation is stable for up to one week at 2-4C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -80C. Avoid repeated freeze/thaw cycles.
Molecular Weight
16.3 kDa
Description
Recombinant human CD40 Ligand is a non-glycosylated polypeptide chain containing 149 amino acids. CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its mouse counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.
Formulation
Lyophilized from a sterile filtered solution in PBS, pH 7.0
Reconstitution
Centrifuge vial prior to opening. Add sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Specificity
„3.3 ca. 102 IU/mg in the presence of 20 ng/ml rHuIL4.
Biological Activity
Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml.
Endotoxin Level
<0.1 ng/ug of recombinant CD40LG

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 15.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen