« Zurück
Home /
Recombinant Human Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial(OXCT1)

Recombinant Human Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial(OXCT1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP017306HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cancer
Uniprot ID	P55809
Gene Names	OXCT1
Organism	Homo sapiens (Human)
AA Sequence	TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLI DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIK RMVSSYVGENAEFERQYLSGELEVELTPQGTLAER IRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGS VAIASKPREVREFNGQHFILEEAITGDFALVKAWK ADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIV DIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSI RKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYA NLGIGIPLLASNFISPNITVHLQSENGVLGLGPYP RQHEADADLINAGKETVTILPGASFFSSDESFAMI RGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMG GAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLP LTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLT VDDVQKSTGCDFAVSPKLMPMQQIAN
Expression Region	40-520aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	56.1 kDa
Alternative Name(s)	3-oxoacid CoA-transferase 1Somatic-type succinyl-CoA:3-oxoacid CoA-transferase ; SCOT-s
Relevance	Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
Reference	Clinical and molecular characterization of five patients with succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.Fukao T., Sass J.O., Kursula P., Thimm E., Wendel U., Ficicioglu C., Monastiri K., Guffon N., Baric I., Zabot M.T., Kondo N.Biochim. Biophys. Acta 1812:619-624(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
Involvement in disease	Succinyl-CoA:3-oxoacid CoA transferase deficiency (SCOTD)
Subcellular Location	Mitochondrion matrix
Protein Families	3-oxoacid CoA-transferase family
Tissue Specificity	Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP017306HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen