Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
50ug |
Host |
E.coli |
ArtNr |
CSB-EP019153HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Cancer |
Target / Protein |
RAB11A |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P62491 |
AA Sequence |
GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEF NLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL KELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA FAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIV SQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ CC |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-213aa |
Protein length |
Full Length of Mature Protein |
MW |
39.9 kDa |
Alternative Name(s) |
YL8 |
Relevance |
The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different set of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of mbrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical mbrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma mbrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma mbrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma mbrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral mbranes. May also play a role in melanosome transport and release from melanocytes. |
References |
Identification and characterization of a human homolog of the Schizosaccharomyces pombe ras-like gene YPT-3.Drivas G.T., Shih A., Coutavas E.E., D'Eustachio P., Rush M.G.Oncogene 6:3-9(1991) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. May also play a role in melanosome transport and release from melanocytes. |
Subcellular Location |
Cell membrane, Lipid-anchor, Recycling endosome membrane, Lipid-anchor, Cleavage furrow, Cytoplasmic vesicle, phagosome |
Protein Families |
Small GTPase superfamily, Rab family |
Paythway |
Endocytosis |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.