Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP019180HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Cancer |
Uniprot ID |
P61019 |
Gene Names |
RAB2A |
Organism |
Homo sapiens (Human) |
AA Sequence |
AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHD LTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSI TRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREH GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF DINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC |
Expression Region |
2-212aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
39.4 kDa |
Relevance |
Required for protein transport from the endoplasmic reticulum to the Golgi complex. |
Reference |
Nucleotide sequence of a new YPT1-related human cDNA which belongs to the ras gene superfamily.Tachibana K., Umezawa A., Kato S., Takano T.Nucleic Acids Res. 16:10368-10368(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Required for protein transport from the endoplasmic reticulum to the Golgi complex. |
Subcellular Location |
Endoplasmic reticulum-Golgi intermediate compartment membrane, Lipid-anchor, Melanosome, Endoplasmic reticulum membrane, Lipid-anchor, Golgi apparatus membrane, Lipid-anchor |
Protein Families |
Small GTPase superfamily, Rab family |
Paythway |
AMPKSignaling |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.