« Zurück
Home /
Recombinant Human Ras-related protein Rab-5A(RAB5A)

Recombinant Human Ras-related protein Rab-5A(RAB5A)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP019213HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Developmental Biology
Uniprot ID	P20339
Gene Names	RAB5A
Organism	Homo sapiens (Human)
AA Sequence	MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSS LVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNE ESFARAKNWVKELQRQASPNIVIALSGNKADLANK RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFM AIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN QCCSN
Expression Region	1-215aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.7 kDa
Relevance	The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB5A is required for the fusion of plasma mbranes and early endosomes. Contributes to the regulation of filopodia extension.
Reference	Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.Kirsten M.L., Baron R.A., Seabra M.C., Ces O.Mol. Membr. Biol. 30:303-314(2013)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome, Cytoplasmic vesicle, Cell projection, ruffle, Membrane, Cytoplasm, cytosol, Cytoplasmic vesicle, phagosome membrane, Endosome membrane
Protein Families	Small GTPase superfamily, Rab family
Paythway	Rassignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019213HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen