Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP019259HU-500 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
RAD23A |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P54725 |
AA Sequence |
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAE KGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN FVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPP APTSGMSHPPPAAREDKSPSEESAPTTSPESVSGS VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGY ERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEH GSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMR QVIQQNPALLPALLQQLGQENPQLLQQISRHQEQF IQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQ VTPQEKEAIERLKALGFPESLVIQAYFACEKNENL AANFLLSQNFDDE |
Tag Info |
N-terminal GST-tagged |
Expression Region |
1-363aa |
Protein length |
Full Length |
MW |
66.6 kDa |
Relevance |
Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome. |
References |
Components of the ubiquitin-proteasome pathway compete for surfaces on Rad23 family proteins.Goh A.M., Walters K.J., Elsasser S., Verma R., Deshaies R.J., Finley D., Howley P.M.BMC Biochem. 9:4-4(2008) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.; FUNCTION |
Subcellular Location |
Nucleus |
Protein Families |
RAD23 family |
Paythway |
Proteinprocessinginendoplasmicreticulum |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.