Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Format |
Liquid or Lyophilized powder |
Menge |
1mg |
Host |
E.coli |
ArtNr |
CSB-EP019557HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Areas |
Cell Adhesion |
Target / Protein |
RELN |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P78509 |
AA Sequence |
AAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLH IAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTS TSVQASQSIGGSSAFGFGIMSDHQFGNQFMCSVVA SHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRG QVIFKDALAQQLCEQGAPTDVTVHPHLAEIHSDSI ILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIM HGNAVTFCEPYGPRELITT |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
26-254aa |
Protein Length |
Partial |
MW |
28.9 kDa |
Distributor Discount |
50% off the list price |
Relevance |
Extracellular domain matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it ses to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the Extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation . |
Reference |
Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation (By similarity). |
Involvement in disease |
Lissencephaly 2 (LIS2); Epilepsy, familial temporal lobe, 7 (ETL7) |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Protein Families |
Reelin family |
Tissue Specificity |
Abundantly produced during brain ontogenesis by the Cajal-Retzius cells and other pioneer neurons located in the telencephalic marginal zone and by granule cells of the external granular layer of the cerebellum. In adult brain, preferentially expressed in GABAergic interneurons of prefrontal cortices, temporal cortex, hippocampus and glutamatergic granule cells of cerebellum. Expression is reduced to about 50% in patients with schizophrenia. Also expressed in fetal and adult liver. |
Paythway |
PI3K-Aktsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.