« Zurück
Home /
Recombinant Human Myosin-9(MYH9) ,partial

Recombinant Human Myosin-9(MYH9) ,partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid
Menge	1mg
Host	E.coli
ArtNr	CSB-RP014054h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Cell Cycle
Target / Protein	MYH9
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P35579
AA Sequence	AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPS DKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDD IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYY SGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGK KRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES GAGKTENTKKVIQYLAYVASSHKSKKDQGELERQL LQANPILEAFGNAKTVKNDNSSRFGKFIRI
Tag Info	N-terminal GST-tagged
Expression Region	2-241aa
Protein length	Partial
MW	54.2 kDa
Alternative Name(s)	Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ; NMMHC-ANon-muscle myosin heavy chain IIa ; NMMHC II-a ; NMMHC-IIA
Relevance	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
References	A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Involvement in disease	May-Hegglin anomaly (MHA); Sebastian syndrome (SBS); Fechtner syndrome (FTNS); Epstein syndrome (EPSTNS); Deafness, autosomal dominant, 17 (DFNA17); Macrothrombocytopenia and progressive sensorineural deafness (MPSD)
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, cell cortex
Protein Families	TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Tissue Specificity	In the kidney, expressed in the glomeruli. Also expressed in leukocytes.
Paythway	Regulationofactincytoskeleton

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen