« Zurück
Home /
Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Recombinant Human Cytochrome c1, heme protein, mitochondrial(CYC1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP015154h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	P08574
Gene Names	CYC1
Organism	Homo sapiens (Human)
AA Sequence	SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ VCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEV QDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAAN NGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTG VSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGT PATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLM MMALLVPLVYTIKRHKWSVLKSRKLAYRPPK
Expression Region	85-325aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	54.4 kDa
Alternative Name(s)	Complex III subunit 4Complex III subunit IVCytochrome b-c1 complex subunit 4Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit ; Cytochrome c-1
Relevance	This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Reference	Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
Involvement in disease	Mitochondrial complex III deficiency, nuclear 6 (MC3DN6)
Subcellular Location	Mitochondrion inner membrane, Single-pass membrane protein, Intermembrane side
Protein Families	Cytochrome c family
Paythway	Cardiacmusclecontraction

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen