Vergleich

Recombinant Human Replication protein A 32KDA subunit(RPA2),partial

Hersteller Cusabio
Kategorie
Typ Proteins Recombinant
Specific against other
Menge 200ug
Host E.coli
ArtNr CSB-RP015554h-200
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P15927
Gene Names
RPA2
Organism
Homo sapiens (Human)
AA Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQA EKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVR QWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQ PSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQA VDFLSNEGHIYSTVDDDHFKST
Expression Region
1-267aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
55.9 kDa
Alternative Name(s)
Replication factor A protein 2 ; RF-A protein 2Replication protein A 34KDA subunit ; RP-A p34
Relevance
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER) probably through interaction with UNG. Through RFWD3 may activate CHEK1 and play a role in replication checkpoint control. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance
Reference
The ionizing radiation-induced replication protein A phosphorylation response differs between ataxia telangiectasia and normal human cells.Liu V.F., Weaver D.T.Mol. Cell. Biol. 13:7222-7231(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER) probably through interaction with UNG. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance.
Subcellular Location
Nucleus, Nucleus, PML body
Protein Families
Replication factor A protein 2 family
Paythway
DNArepairpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen