« Zurück
Home /
Recombinant Human Transcription factor BTF3(BTF3),partial

Recombinant Human Transcription factor BTF3(BTF3),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP017144h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transcription
Uniprot ID	P20290
Gene Names	BTF3
Organism	Homo sapiens (Human)
AA Sequence	TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTAT ADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIH FNNPKVQASLAANTFTITGHAETKQLTEMLPSILN QLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDD DEVPDLVENFDEASKNEAN
Expression Region	48-206aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44.3 kDa
Alternative Name(s)	Nascent polypeptide-associated complex subunit beta ; NAC-betaRNA polymerase B transcription factor 3
Relevance	When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they erge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Reference	Sequencing and expression of complementary DNA for the general transcription factor BTF3.Zheng X.M., Black D., Chambon P., Egly J.-M.Nature 344:556-559(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.
Subcellular Location	Cytoplasm, Nucleus
Protein Families	NAC-beta family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen