Recombinant Human Signal recognition particle 14KDA protein(SRP14),partial

Epigenetics and Nuclear Signaling

SRP14

VLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGR TKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVV SSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKT KA

Partial

N-terminal GST-tagged

18KDA Alu RNA-binding protein

Analysis of the DNA sequence and duplication history of human chromosome 15.Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.Nature 440:671-675(2006)

Tris-based buffer, 50% glycerol

Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Cytoplasm

N-terminal GST-tagged