« Zurück
Home /
Recombinant Human Polycomb complex protein BMI-1(BMI1),partial

Recombinant Human Polycomb complex protein BMI-1(BMI1),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-RP033454h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Transcription
Uniprot ID	P35226
Gene Names	BMI1
Organism	Homo sapiens (Human)
AA Sequence	MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECL HSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSAD AANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHL RKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTN AGELE
Expression Region	1-250aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.4 kDa
Alternative Name(s)	Polycomb group RING finger protein 4RING finger protein 51
Relevance	Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin rodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Reference	Characterization and chromosomal localization of the human proto-oncogene BMI-1.Alkema M.J., Wiegand J., Raap A.K., Berns A., van Lohuizen M.Hum. Mol. Genet. 2:1597-1603(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility
Subcellular Location	Nucleus, Cytoplasm

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen