« Zurück
Home /
Recombinant Mouse Protein disulfide-isomerase A2(Pdia2)

Recombinant Mouse Protein disulfide-isomerase A2(Pdia2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP017719MO-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	D3Z6P0
Gene Names	Pdia2
Organism	Mus musculus (Mouse)
AA Sequence	QGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTL SLALQEHSALMVEFYAPWCGHCKELAPEYSKAAAL LAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKF FQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATH LEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLA LAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKF DEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEF NSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDF REAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEE APTLRLINVETTKKYAPTGVIAITAASVAAFCQAV LHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVA FDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKD REDIVIAELDATANELEAFSVLGYPTLKFFPAGPD RKVIDYKSTRDLETFSKFLDSGGHLPKEEPKEPAA SAPEAQANSTLGPKEEL
Expression Region	21-527aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	72.2 kDa
Relevance	Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins .
Reference	Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins (By similarity).
Subcellular Location	Endoplasmic reticulum lumen
Protein Families	Protein disulfide isomerase family
Tissue Specificity	Highly expressed in pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen