Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
ArtNr |
CSB-CF006254HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
P61073 |
Gene Names |
CXCR4 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFRE ENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQ KKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVAN WYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYL AIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPD FIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMV GLILPGIVILSCYCIIISKLSHSKGHQKRKALKTT VILILAFFACWLPYYIGISIDSFILLEIIKQGCEF ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKT SAQHALTSVSRGSSLKILSKGKRGGHSSVSTESES SSFHSS |
Expression Region |
1-356aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
in vitro E.coli expression system |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
56.2 kDa |
Alternative Name(s) |
FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 receptor CD_antigen: CD184 |
Relevance |
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.10 Publications (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed:9427609, PubMed:10074122, PubMed:10756055). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205) |
Reference |
"A proposed bovine neuropeptide Y (NPY) receptor cDNA clone, or its human homologue, confers neither NPY binding sites nor NPY responsiveness on transfected cells."Jazin E.E., Yoo H., Blomqvist A.G., Yee F., Weng G., Walker M.W., Salon J., Larhammar D., Wahlestedt C.R.Regul. Pept. 47:247-258(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. |
Involvement in disease |
WHIM syndrome (WHIMS) |
Subcellular Location |
Cell membrane, Multi-pass membrane protein, Cell junction, Early endosome, Late endosome, Lysosome |
Protein Families |
G-protein coupled receptor 1 family |
Tissue Specificity |
Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested. |
Paythway |
Chemokinesignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.