« Zurück
Home /
Recombinant Rat Aminopeptidase N(Anpep),partial

Recombinant Rat Aminopeptidase N(Anpep),partial

Hersteller	Cusabio
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP001827RA-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Immunology
Uniprot ID	P15684
Gene Names	Anpep
Organism	Rattus norvegicus (Rat)
AA Sequence	YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDE SKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYI FKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRV ALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVK GHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVV ATTQMQAADARKSFPCFDEPAMKASFNITLIHPNN LTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTY LLAYIVSEFKYVEAVSPNRVQIRIWARPSAIDEGH GDYALQVTGPILNFFAQHYNTAYPLEKSDQIALPD FNAGAMENWGLVTYRESALVFDPQSSSISNKERVV TVIAHELAHQWFGNLVTVDWWNDLWLNEGFASYVE FLGADYAEPTWNLKDLIVLNDVYRVMAVDALASSH PLSSPANEVNTPAQISELFDSITY
Expression Region	33-476aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	65.8 kDa
Alternative Name(s)	Short name: AP-N Short name: rAPN Alternative name(s): Alanyl aminopeptidase Aminopeptidase M Short name: AP-M Kidney Zn peptidase Short name: KZP Microsomal aminopeptidase CD_antigen: CD13
Relevance	Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines and involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis
Reference	Molecular cloning and amino acid sequence of rat kidney aminopeptidase M: a member of a super family of zinc-metallohydrolases.Malfroy B., Kado-Fong H., Gros C., Giros B., Schwartz J.C., Hellmiss R.Biochem. Biophys. Res. Commun. 161:236-241(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization.
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Protein Families	Peptidase M1 family
Tissue Specificity	Widely distributed throughout the CNS. Particularly abundant in kidney and intestinal microvilli, also detected in lung and liver. Weakly expressed in heart and aorta.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP001827RA-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen