Vergleich

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1),partial

Hersteller Cusabio
Kategorie
Typ Proteins Recombinant
Specific against Human
Format Liquid or Lyophilized powder
Menge 1mg
Host E.coli
ArtNr CSB-EP005157HU-1
Konjugat/Tag Myc
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Research Areas
Tags & Cell Markers
Target / Protein
CEACAM1
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P13688
AA Sequence
QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYK GERVDGNRQIVGYAIGTQQATPGPANSGRETIYPN ASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFH VYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDT TYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRND TGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISP SDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQ STQELFIPNITVNNSGSYTCHANNSVTGCNRTTVK TIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCS TNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSIN PVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNAL PQENGLSPG
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
35-428aa
Protein Length
Extracellular Domain
MW
63.3 kDa
Distributor Discount
50% off the list price
Alternative Name(s)
Biliary glycoprotein 1
Short name:BGP-1
Reference
Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Nakazato H., Matsuoka Y.Biochem. Biophys. Res. Commun. 176:578-585(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Isoform 1
Subcellular Location
Isoform 1: Cell membrane, Single-pass type I membrane protein, Lateral cell membrane, Apical cell membrane, Basal cell membrane, Cell junction, Cell junction, adherens junction, Note=Canalicular domain of hepatocyte plasma membranes, Found as a mixture of monomer, dimer and oligomer in the plasma membrane, Occurs predominantly as cis-dimers and/or small cis-oligomers in the cell junction regions, Found as dimer in the solution, Predominantly localized to the lateral cell membranes, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 6: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 7: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 8: Cell membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Lateral cell membrane, Apical cell membrane, Basal cell membrane, Cell junction, Cell junction, adherens junction, Note=Predominantly localized to the lateral cell membranes, Found as a mixture of monomer, dimer and oligomer in the plasma membrane, Occurs predominantly as cis-dimers and/or small cis-oligomers in the cell junction regions (By similarity), Co-localizes with ANXA2 in secretory vesicles and with S100A10/p11 at the plasma membrane (PubMed:14522961), SUBCELLULAR LOCATION: Cell projection, microvillus membrane, Single-pass type I membrane protein, Apical cell membrane, Single-pass type I membrane protein
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
The predominant forms expressed by T cells are those containing a long cytoplasmic domain (PubMed:18424730). Expressed in granulocytes and lymphocytes. Leukocytes only express isoforms 6 and isoform 1 (PubMed:11994468).
Tag Information
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen