« Zurück
Home /
Recombinant Human Neuronal migration protein doublecortin(DCX)

Recombinant Human Neuronal migration protein doublecortin(DCX)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Brain Cancer Stem Cell Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP006576HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Neuroscience
Uniprot ID	O43602
Gene Names	DCX
Organism	Homo sapiens (Human)
AA Sequence	MKTLPLHSHCTEMQRLLPKLEMLTLGSSFCSLQGE FCQAMDSFTTVSHVGMCEETDASFNVFSPKFQFDR SHCQSLRFHQNMELDFGHFDERDKTSRNMRGSRMN GLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYR NGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDN INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSS DNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLAS SNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLL NKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGK QVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDEN ECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRS KSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLR KHKDLYLPLSLDDSDSLGDSM
Expression Region	1-441aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	65.3 kDa
Alternative Name(s)	Doublin Lissencephalin-X Short name: Lis-X
Relevance	Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration.
Reference	"A novel CNS gene required for neuronal migration and involved in X-linked subcortical laminar heterotopia and lissencephaly syndrome." Des Portes V., Pinard J.-M., Billuart P., Vinet M.-C., Koulakoff A., Carrie A., Gelot A., Dupuis E., Motte J., Berwald-Netter Y., Catala M., Kahn A., Beldjord C., Chelly J.Cell 92:51-61(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration.
Involvement in disease	Lissencephaly, X-linked 1 (LISX1); Subcortical band heterotopia X-linked (SBHX)
Subcellular Location	Cytoplasm, Cell projection
Tissue Specificity	Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low expression in other regions of brain, and not detected in heart, placenta, lung, liver, skeletal muscles, kidney and pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006576HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen