Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP007659CH-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Neuroscience |
Target / Protein |
EN1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Gallus gallus (Chicken) |
Uniprot ID |
Q05916 |
AA Sequence |
MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSA PVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNF FIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGR EQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSN CAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGD GGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQ PLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDK RPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQE LSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMA QGLYNHSTTTVQDKEESE |
Tag Info |
N-terminal 6xHis-B2M-tagged |
Expression Region |
1-333aa |
Protein length |
Full Length |
MW |
48.5 kDa |
Alternative Name(s) |
Short name:Gg-En-1 Short name:Homeobox protein en-1 |
References |
"Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions."Logan C., Hanks M.C., Noble-Topham S., Nallainathan D., Provart N.J., Joyner A.L.Dev. Genet. 13:345-358(1992) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Subcellular Location |
Nucleus |
Protein Families |
Engrailed homeobox family |
Tag Information |
N-terminal 6xHis-B2M-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.