« Zurück
Home /
Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

Hersteller	Cusabio
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP009514MO1-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Neuroscience
Target / Protein	Glp1r
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	O35659
AA Sequence	GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLL ATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSEC EESKRGERNFPEEQLLSLY
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	22-145aa
Protein Length	Partial
MW	30.4 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Relevance	This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference	Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene.Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 2 family
Tissue Specificity	Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen