« Zurück
Home /
Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)

Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009870PI-10
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Signal Transduction
Target / Protein	GPX5
Biologically active	Not Test
Expression system	E.coli
Species of origin	Sus scrofa (Pig)
Uniprot ID	O18994
AA Sequence	NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQ YAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFG LVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGY VPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELI GSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRW VHETPISTVKSDILAYLKQFKTE
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	22-219aa
Protein length	Full Length of Mature Protein
MW	27.6 kDa
Alternative Name(s)	Epididymis-specific glutathione peroxidase-like protein Short name:EGLP
Relevance	May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
References	"Molecular cloning and characterization of the epididymis-specific glutathione peroxidase-like protein secreted in the porcine epididymal fluid."Okamura N., Iwaki Y., Hiramoto S., Tamba M., Bannai S., Sugita Y., Syntin P., Dacheux F., Dacheux J.-L.Biochim. Biophys. Acta 1336:99-109(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Subcellular Location	Secreted
Protein Families	Glutathione peroxidase family
Tissue Specificity	Proximal caput epididymis.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen