« Zurück
Home /
Recombinant Rat Gremlin-1(Grem1)

Recombinant Rat Gremlin-1(Grem1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009892RA-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	O35793
Gene Names	Grem1
Organism	Rattus norvegicus (Rat)
AA Sequence	KKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRG RGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWC KTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPR HIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPP TKKKRVTRVKQCRCISIDLD
Expression Region	25-184aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	34.2 kDa
Alternative Name(s)	Cysteine knot superfamily 1, BMP antagonist 1 Down-regulated in Mos-transformed cells protein
Relevance	Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner (By similarity). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed.
Reference	"Identification of drm, a novel gene whose expression is suppressed in transformed cells and which can inhibit growth of normal but not transformed cells in culture."Topol L.Z., Marx M., Laugier D., Bogdanova N.N., Boubnov N.V., Clausen P.A., Calothy G., Blair D.G.Mol. Cell. Biol. 17:4801-4810(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner (By similarity). Antagonist of BMP2; inhibits BMP2-mediated differentiation of osteoblasts (in vitro) (By similarity). Acts as inhibitor of monocyte chemotaxis
Subcellular Location	Secreted
Protein Families	DAN family
Tissue Specificity	Highly expressed in the brain, kidney, spleen, and testis and weakly expressed in the lung and liver. Predominantly expressed in differentiated cells as neurons in brain, type I cells in lung and globlet cells in intestine.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen