Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP009994HU-10 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
O43708 |
Gene Names |
GSTZ1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVP INLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIH QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDL IAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAER FKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT PTELRA |
Expression Region |
1-216aa |
Sequence Info |
Full Length of BC001453 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
51.1 kDa |
Alternative Name(s) |
GSTZ1-1 Glutathione S-transferase zeta 1 (EC:2.5.1.18) |
Relevance |
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1, 3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. |
Reference |
"Characterization of a fungal maleylacetoacetate isomerase gene and identification of its human homologue." Fernandez-Canon J.M., Penalva M.A. J. Biol. Chem. 273:329-337(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1, 3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. |
Involvement in disease |
Maleylacetoacetate isomerase deficiency (MAAID) |
Subcellular Location |
Cytoplasm |
Protein Families |
GST superfamily, Zeta family |
Tissue Specificity |
Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart. |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.