« Zurück
Home /
Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1)

Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1)

Hersteller	Cusabio
Kategorie	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP010609HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transcription
Uniprot ID	P31943
Gene Names	HNRNPH1
Organism	Homo sapiens (Human)
AA Sequence	MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKI QNGAQGIRFIYTREGRPSGEAFVELESEDEVKLAL KKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPD TANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGI TLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERI GHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYD RPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDY NGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGS TFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVR VHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKAN MQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAG ASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYG GGYGGQSSMSGYDQVLQENSSDFQSNIA
Expression Region	2-449aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	65.1 kDa
Relevance	This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Reference	Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.Honore B., Rasmussen H.H., Vorum H., Dejgaard K., Liu X., Gromov P., Madsen P., Gesser B., Tommerup N., Celis J.E.J. Biol. Chem. 270:28780-28789(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Subcellular Location	Nucleus, nucleoplasm
Tissue Specificity	Expressed ubiquitously.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP010609HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen