« Zurück
Home /
Recombinant Mouse Interleukin-7 receptor subunit alpha(Il7r),partial

Recombinant Mouse Interleukin-7 receptor subunit alpha(Il7r),partial

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP011670MO-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	P16872
Gene Names	Il7r
Organism	Mus musculus (Mouse)
AA Sequence	ESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLL TCAFNDSDINTANLEFQICGALLRVKCLTLNKLQD IYFIKTSEFLLIGSSNICVKLGQKNLTCKNMAINT IVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYL KKVKHDVAYRPARGESNWTHVSLFHTRTTIPQRKL RPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETP EPKNQGGWD
Expression Region	21-239aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	41 kDa
Alternative Name(s)	Short name: IL-7 receptor subunit alpha Short name: IL-7R subunit alpha Short name: IL-7R-alpha Short name: IL-7RA
Relevance	Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Reference	"Structural basis of the proinflammatory signaling complex mediated by TSLP."Verstraete K., van Schie L., Vyncke L., Bloch Y., Tavernier J., Pauwels E., Peelman F., Savvides S.N.Nat. Struct. Mol. Biol. 21:375-382(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity	Spleen, thymus and fetal liver.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP011670MO-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen