Vergleich

Recombinant Human Thrombopoietin receptor(MPL),partial

Hersteller Cusabio
Kategorie
Typ Proteins Recombinant
Specific against Human
Format Liquid or Lyophilized powder
Menge 100ug
Host E.coli
ArtNr CSB-EP014755HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Research Areas
Immunology
Target / Protein
MPL
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P40238
AA Sequence
QDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQF PDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSV GLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFL RYELRYGPRDPKNSTGPTVIQLIATETCCPALQRP HSASALDQSPCAQPTMPWQDGPKQTSPSREASALT AEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWG SWSLPVTVDLPGDAVALGLQCFTLDLKNVTCQWQQ QDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKT NPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTV HSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEW QHPSSWAAQETCYQLRYTGEGHQDWKVLEPPLGAR GGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAW
Tag Info
N-terminal 6xHis-tagged
Expression Region
26-491aa
Protein Length
Extracellular Domain
MW
56.5 kDa
Distributor Discount
50% off the list price
Alternative Name(s)
Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD110
Relevance
Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Reference
The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Involvement in disease
Congenital amegakaryocytic thrombocytopenia (CAMT); Thrombocythemia 2 (THCYT2); Myelofibrosis with myeloid metaplasia (MMM)
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Golgi apparatus, Cell surface
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
Paythway
Jak-STATsignalingpathway
Tag Information
N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen